Web stats for Greetingsfrompoland - greetingsfrompoland.com
Tours to Poland 2014 - largest selection of offers for your tours to Poland 2014. Come to Poland and visit our beautiful country. GFP Travel is a licensed.
1.83 Rating by ClearWebStats
greetingsfrompoland.com is 1 decade 5 years 9 months old. This website has a #3,311,158 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 1 out of 10. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, greetingsfrompoland.com is SAFE to browse.
Traffic Report of Greetingsfrompoland
Daily Unique Visitors: | 145 |
Daily Pageviews: | 290 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | 2 |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | 10 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank
PR 1 out of 10
PageSpeed Score
74
Siteadvisor Rating
Not Applicable
Where is greetingsfrompoland.com server located?
Social Engagement
Facebook Shares: | 2 |
Facebook Likes: | 2 |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 3 | H2 Headings: | 2 |
H3 Headings: | Not Applicable | H4 Headings: | 5 |
H5 Headings: | 1 | H6 Headings: | 2 |
Total IFRAMEs: | Not Applicable | Total Images: | 5 |
Google Adsense: | Not Applicable | Google Analytics: | UA-12324923-1 |
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: max-age=3, must-revalidate
Content-Type: text/html; charset=UTF-8
Date: Mon, 16 Jun 2014 17:55:28 GMT
Server: IdeaWebServer/v0.80
Transfer-Encoding: chunked
Vary: Accept-Encoding, Cookie
WP-Super-Cache: Served supercache file from PHP
Status-Code: 200
Status: 200 OK
Cache-Control: max-age=3, must-revalidate
Content-Type: text/html; charset=UTF-8
Date: Mon, 16 Jun 2014 17:55:28 GMT
Server: IdeaWebServer/v0.80
Transfer-Encoding: chunked
Vary: Accept-Encoding, Cookie
WP-Super-Cache: Served supercache file from PHP
Domain Information for greetingsfrompoland.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
greetingsfrompoland.com | A | 3588 |
IP:79.96.4.63 |
greetingsfrompoland.com | NS | 86400 |
Target:dns.home.pl |
greetingsfrompoland.com | NS | 86400 |
Target:dns2.home.pl |
greetingsfrompoland.com | NS | 86400 |
Target:dns3.home.pl |
greetingsfrompoland.com | SOA | 86400 |
MNAME:dns.home.pl RNAME:admin.home.pl Serial:1371812695 Refresh:10800 Retry:3600 Expire:604800 |
greetingsfrompoland.com | MX | 3600 |
Priority:30 Target:ALT2.ASPMX.L.GOOGLE.com |
greetingsfrompoland.com | MX | 3600 |
Priority:20 Target:ALT1.ASPMX.L.GOOGLE.com |
greetingsfrompoland.com | MX | 3600 |
Priority:40 Target:ASPMX2.GOOGLEMAIL.com |
greetingsfrompoland.com | MX | 3600 |
Priority:10 Target:ASPMX.L.GOOGLE.com |
Similarly Ranked Websites to Greetingsfrompoland
The Original Smoothie Bombs™ – The Smoothie Bombs
- thesmoothiebombs.com
pre-portioned smoothie boosters
Palm Springs Hotel | 7 Springs Hotel
- palm-springs-hotels.cc
Palm Springs hotel the 7 Springs offers amazing accommodations and service that you want in a hotel in Palm Springs.
Happy Independence Day 2020
- independentdaygift.pinkvillapro.com
Create Happy Independence Day Wishes, 15 August 2020, Happy Independence Day 2020 wishing website
Business Insurance Agents Portland, Lake Oswego | Bisnett Insurance
- bisnett.com
Bisnett Insurance are independent Insurance agents in Lake Oswego, Hood River, Pendleton, John Day, Ketchum, Milton Freewater and Baker City providing auto, home, farm, ranch, health, life and watercraft insurance. Call us for a quote on insuring your small business. 503.635.4482